SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81529.m00518 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81529.m00518
Domain Number 1 Region: 18-261
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.18e-38
Family ROO N-terminal domain-like 0.0000243
Further Details:      
 
Domain Number 2 Region: 267-415
Classification Level Classification E-value
Superfamily Flavoproteins 2.72e-28
Family Flavodoxin-related 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 81529.m00518
Sequence length 417
Sequence
MLSTSSARSFSALDLGVTKVADDVLWIGVNDWDLREFHSMQSPVGTSYNSYLIQSSEPTI
VDAVKYTMAHAWIDRLKSIGGDDLKGIKRIIVQHAEPDHSSGTAMLVKEAPHIEVVMTKQ
CYNTMARFYDVSKWNVKIVKLGEKINLGDRVAVMAGVPMAHWPESAVTYLPAQKILFSSD
CFGQHIASNKRFVDEVDQGLFLTEIKSYYANILQRLGKPVLKALATASKLPGLDIVLPAH
GVGFRRKEDLEQAIKLYTQWATYKPNPKVSVIYDCNWYGTEKMAEAVASGICKEKLECIM
MNARKTHITRSATEVMDSAAVAFGSSTLHECILPDIAMHLNYLRCLGIHDKPVGLFGTFG
WQEKIVPNELRNAIVKPCKIPEVAEPVMAHWNPKEADLAKCEELGRKLALAAIEKCK
Download sequence
Identical sequences Q6XKE2
gi|121917804|gb|EAY22576.1| gi|154421096|ref|XP_001583562.1| 5722.Q6XKE2 81529.m00518 XP_001583562.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]