SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81982.m00114 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81982.m00114
Domain Number 1 Region: 478-669
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.83e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0052
Further Details:      
 
Domain Number 2 Region: 11-282
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.92e-41
Family ROO N-terminal domain-like 0.0000653
Further Details:      
 
Domain Number 3 Region: 621-784
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.64e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0063
Further Details:      
 
Domain Number 4 Region: 259-407
Classification Level Classification E-value
Superfamily Flavoproteins 5.94e-24
Family Flavodoxin-related 0.005
Further Details:      
 
Domain Number 5 Region: 434-470
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000387
Family Rubredoxin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 81982.m00114
Sequence length 871
Sequence
MLKIQQLTEDIYWLGVLDSNLAVFDIIMETKYGTTYNAYLIKTPEGAVLVETVKETFFDE
YIEKVKSVIGDIHKIKYLITNHTEPDHSGSIKKMIELIPDLTVVGSKTALTYLEDIVNIP
FKGHSAEDLKVLKFGGKSFEFISCPFLHWPDSMYTWVPEEKTLFTCDSFGAHYSPKKSIL
MSQLPPEEEEGYQDALLYYYTAIFGPFKEYVIKGTDKILNLDIKLVGLGHGPVLDARIKE
TIDTYRKWSAPLPTHEGKEVVMVYASAYGYTTEMAEEIKAGILAKIPDAKIKMFNVNIQN
YGGLKGEIMNAIATADGVLLGTNTINGDAVPPVWDVALSMNPIVHGGKIVTAFGSYGWSG
EGVDNIIARFDQIRCKVIDGCKIKFRMSKKEHGKVNEFGQQFGEALITGKVPERAVPGKV
VGAKDWSELNPTGAVVLWRCVICGEIYAGVTPPLQCPACGVGQDLFELYEAEQVTHKSTE
PLNYVIVGSGAAAVASIEAIRARNAVAKITMISREKVMPYYRPIIVDALNAEIAPDKYFL
KNEEWYKENKIEIKLDTSVTAIDTKAKKVKLCRGDELAYDKLILATGSRPFIPPIGHEGL
SGVIVIRTSADVDQLKAACQTAKKAVVIGGGVLGLENASAIKEKGVAVTVVECMPRLMAR
QLDTEASAVLLEEVKKFGVDVRLGMTVSIKGDGKHVTGVQVGEEFIPADFVVVNAGVRAE
SEVAAAAGIKCGRGIIVNNKMETNVPDVYAAGDCAFLDNMNQGLWAPALAMGKVAGANAC
GDNKTFAFAIEPVSMIAMGTDLFACGNPPESAQGYNVVSQKDDKEGSAIKLYFKDNRLVY
AAGFRIQKISGSLLKGVREGRSLERIMAEIF
Download sequence
Identical sequences A2EVX8
XP_001315422.1.43485 gi|121898098|gb|EAY03199.1| gi|123455353|ref|XP_001315422.1| 81982.m00114 5722.A2EVX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]