SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 82140.m00098 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  82140.m00098
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.39e-65
Family Ankyrin repeat 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 82140.m00098
Sequence length 190
Sequence
MDDDRFSPLIMASRHGHLEVVKYLISVGADMEAQNLDGYSPLIIASRYGHLEVVKYLISA
GADKEAKDIYGATPLIKASKNGHLEVVKYLISVSADKEAKDVGGNTPLFYASYYGQLEVV
KYLISVGADIEAKDENGNTAFILASESGHLEVVKYLISVGVDEKAKNNDGDSALSLASDD
VRDYLISIGA
Download sequence
Identical sequences A2ETI5
5722.A2ETI5 82140.m00098 gi|121898955|gb|EAY04031.1| gi|123457046|ref|XP_001316254.1| XP_001316254.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]