SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 83007.m00283 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  83007.m00283
Domain Number 1 Region: 169-309
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 7.19e-25
Family Staphylococcal nuclease 0.0071
Further Details:      
 
Domain Number 2 Region: 312-457
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.18e-20
Family Staphylococcal nuclease 0.0056
Further Details:      
 
Domain Number 3 Region: 3-152
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.44e-17
Family Staphylococcal nuclease 0.015
Further Details:      
 
Domain Number 4 Region: 623-645,723-840
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000011
Family Staphylococcal nuclease 0.021
Further Details:      
 
Domain Number 5 Region: 483-616
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000000262
Family Staphylococcal nuclease 0.01
Further Details:      
 
Domain Number 6 Region: 659-734
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000012
Family Tudor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 83007.m00283
Sequence length 849
Sequence
MSKPRRGIVQAVIDGCTLIVKFVDEPSKPVEAVLLDFITAPKLGSNDGVRPDEPDAWNSF
DFLRKLTLGKRVLIYPANTKGDIFRNHPNFGRIPGFPGRAELVDKGNMDVGMAVVESGWG
KVKNERSQDDYAQQLLTLQTAASDESRGMWTASGLVRKLPAPYDPDDLLKRKEFEGIIES
VQNGSTYSVILLPNFEVISLQLAGMKCPGARREMPDPFGLEAKQFAEARLLQRGVKVTIH
QAQERSTKNDIFIGQIVHPQGGDIALFLLKEGLGQVFNPTISLIPRGEEYRAAETEAKKA
RKNLWKSFDVSTLKSGRVEGKVVRISGSSCLEIETVTGNIEKVYLSSCKVPLFNPVGQTE
PLGFEAREFVRKLTIGEKAIALIDYTVETQSRGTNATEPRHFATVYIGSKCVQEELVAQG
LATVFTSRNNKPSDRIDSMMRAEDDAKSKRIGLHATKLPNAAAFNDLSNKPNRQKSVPYL
HYLENKNLNGVIEYFASSTRAVILIPEQSCIIRMNLLGVIGNDPTERIGNKALQYMNDNF
LLRDCIVNVRDADKYGCFNGCLTAVVGKKQICLEYDLVRKGFAELHTTISRHPKRTEISE
ALEEAKDEKVGMWGDETRIQKALIPDKVYEVNVTEVWDPVTVVIQIQSEELAKINKGLVQ
ARQAVGKLMKGDLVAVIYERKLYRGRILEVEDQRAKVEFIELCINDTIPIADLRTLPEEL
TKIPPQAMSIRLGGCKAFNFNNQDFEEEAKDYVWSLCDGQTLYAHFMYDDRSAPDPDVLL
TDGPSPENGSVNSMVLSKGYARFNNIPVSKSLEPVMERLDTIESAARDKKVGAWVFGNVG
DDDDDEDEY
Download sequence
Identical sequences A2DM81
gi|121913694|gb|EAY18501.1| gi|154412911|ref|XP_001579487.1| 5722.A2DM81 83007.m00283 XP_001579487.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]