SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 83435.m00052 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  83435.m00052
Domain Number 1 Region: 11-199
Classification Level Classification E-value
Superfamily Flavoproteins 1.07e-36
Family Quinone reductase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 83435.m00052
Sequence length 199
Sequence
MSAQTSKGTALIIDGGCEFNMSKGNLNHYLTDVAKKQLESFGWNVITTVVENGYDIQEEI
DKFLKCNIVILQVPGWWMGLPWQVKKYIDTVFSSGKGTLVKNDGRTRKDPSKKYGTGGLM
IGKHVMISSTWNAPEIAFTEEGQFYADLGKKNHWLTVEKAFKFIGFDVLEGMYFFDVHKN
PHVEQEVEQYKQLLEKYFK
Download sequence
Identical sequences A2FN47
gi|121888160|gb|EAX93647.1| gi|121888161|gb|EAX93648.1| gi|121888166|gb|EAX93653.1| gi|123424417|ref|XP_001306577.1| gi|123424421|ref|XP_001306578.1| gi|123424439|ref|XP_001306583.1| 83435.m00050 83435.m00052 83435.m00054 XP_001306577.1.43485 XP_001306578.1.43485 XP_001306583.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]