SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 83481.m00040 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  83481.m00040
Domain Number 1 Region: 46-182
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.9e-20
Family Retroviral integrase, catalytic domain 0.018
Further Details:      
 
Weak hits

Sequence:  83481.m00040
Domain Number - Region: 285-314
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0752
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 83481.m00040
Sequence length 351
Sequence
MKQQRVWGFTNRAEVKRFFDKNVVHQTKINSYDYFLPIYSNAPDAYQFDTLIQSRKGGHK
PFLIFINVNTRKAYAYPMRNKGTREVLRVLQKFVAEHSPSTLTSDQDSAYLSNEITDFLI
KHNITHYTTEDHNHNILGIINRFIRTLRDLNQERDFTEETMKHFLEVYNSSTHSTTGHTP
NSMTQQQEEKYIQKKRSQTQNIRNSTQFTLIPGTKVRVVLDDKPLTKKRLRLSRNYYIVD
STQGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAKRGVVIEILGYNINDDTYKVR
YEGGVEDVIPSTNLRESKPTHLGPLEREYWKDKNMPERIRKFMKFGHFSPK
Download sequence
Identical sequences 83481.m00040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]