SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 83629.m00189 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  83629.m00189
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000878
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Weak hits

Sequence:  83629.m00189
Domain Number - Region: 208-237
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0842
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 83629.m00189
Sequence length 262
Sequence
MRNKGTREVLRVLQKFVAEHSPSTLTSDQDSAYLSNEITDFLIKHNITHYTTEDHNHNIL
GIINRFIRTLRDLNQERDFTEETMKHFLEVYNSSTHSTTGHTPNSMTQQQEEKYIQKKRS
QTQNIRNSTQFTLIPGTKVRVVLDDKPLTKKRLRLSRNYYIVDSTQGNEYLIKAADDSIA
FYPRHKLVESSNGKLAKTIDEAKRGVVIEILGYNINDDTYKVRYEGGVEDVIPSKNLRES
KPTHLGPLEREYWKDKNMPERI
Download sequence
Identical sequences 83629.m00189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]