SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 83975.m00020 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  83975.m00020
Domain Number 1 Region: 308-449
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.27e-19
Family Staphylococcal nuclease 0.012
Further Details:      
 
Domain Number 2 Region: 164-303
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.53e-16
Family Staphylococcal nuclease 0.015
Further Details:      
 
Domain Number 3 Region: 3-148
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000017
Family Staphylococcal nuclease 0.014
Further Details:      
 
Domain Number 4 Region: 594-675
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000193
Family Tudor domain 0.014
Further Details:      
 
Domain Number 5 Region: 566-587,665-782
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000327
Family Staphylococcal nuclease 0.016
Further Details:      
 
Weak hits

Sequence:  83975.m00020
Domain Number - Region: 498-558
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000183
Family Staphylococcal nuclease 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 83975.m00020
Sequence length 797
Sequence
MEKGIVVGIHAGSSLYIEFIEKEGKPINYIQLFGCHSPLLGTTDGKREDEYEAWTSFNYL
RTLAIGRRCIVRDIKETKNTRNNFTFGTVPFSIGRVELIDYNNMDVRIAMISAGFAKVKS
EIMNDYTRELFRYQDSAKENNRGVWGDTYFLRQLPVKFNPRNLIGKTYEGYIDGFSNGSS
YHVFLLPNFESIHLSLAGVICPLITKDKVFPYANEALYLCKMNLFQRTLKIKIVSYVDTQ
NYFLGIISHKNCPDFGKILLEEGLASIHEPSLSYVPDPENYKMIEEKARKEEKNQWKKFV
VPPEDTISFDGTVMNIRGSSIFEIILDDDTIKRVSLSGVRTPAYNPYDNTSSEPYGFESH
EYLRNLLIGKRVKCIVDSSVTSGETPIYYVSMYLENTLCVNSRIIQNGYGKKNILRSQKI
PSCIDSITEADKFARNEKKGIFSDDVVTPKRFVILSREPSREKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGSFCGSVTVKDGNHEYLLEAEILNGGFASLHVEAQRHPQRQVL
VAAQQSAQRSEVGMWSDSSRTVFRLKKDTIYECKVVSVWDAITVVIAIMSDDFEKIRETI
VNCRTRPKNPMRGDVVGAIFSDKIYRAKISDLNDIEAKVDFIDLCVDDTISVNNLRELPP
EIAAIPPQGLSVRLAFTRPFENEDEDFKKEAEEFLWTAVDGQKLYCHLVVDDINEPDPDV
LLTQHPEIRSTSVNAVMLRTGLCHYETCDFLEDDEILDEISEELDRIELTAKKEGVGAWT
TKTAASYIPDEPDADYL
Download sequence
Identical sequences A2G1N2
5722.A2G1N2 gi|121883097|gb|EAX88936.1| gi|123401469|ref|XP_001301866.1| 83975.m00020 XP_001301866.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]