SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 84285.m00200 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  84285.m00200
Domain Number 1 Region: 11-284
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.04e-43
Family ROO N-terminal domain-like 0.0000675
Further Details:      
 
Domain Number 2 Region: 479-670
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.78e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0049
Further Details:      
 
Domain Number 3 Region: 620-783
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.54e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 
Domain Number 4 Region: 259-405
Classification Level Classification E-value
Superfamily Flavoproteins 8.73e-26
Family Flavodoxin-related 0.0047
Further Details:      
 
Domain Number 5 Region: 434-469
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000774
Family Rubredoxin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 84285.m00200
Sequence length 871
Sequence
MLKIQQLTEDIYWLGVLDSDLAVFDIVMETKYGTTYNAYLIKTPEGAVLVETVKERFFDE
YIDKVKTVIGDIKNIKYLITNHTEPDHSGSIKRMVELLPDVTVVGSKTALTYLEDIMNIP
FKSQSAEDLKVLKFGGKTFEFISCPFLHWPDSMYTHLVEEKTLFTCDSFGAHYSPKKSIL
MSQLPPEEEEGYQDALLYYYTAIFGPFKEYVIKGTDKILNLDIKLICLGHGPVLDARIKE
TIDTYRKWSAPIPPHEGKEVVMVYASAYGYTTEMAEEIKTGIMEKCPDAKVKMFNVNIQN
YGALKGEIMGAIATADGVLLGTNTINGDAVPPIWDVALSMNPIVHGGKVVSAFGSYGWSG
EGVDNIIKRFDQIRCKVIDGMKIKFRMSKKEHEKVREFGNQFGNSLVTGVVPERAVPGKV
VGAKDWSQLNPTGQIVLWRCVICGEIYAGVTPPAQCPACGVSEDLFELYEGEEIAVKSTE
KLNFVVVGSGAAAVAACEAIRQRNSAASIQMITREKIMPYYRPIIVDALHGPIPDDQYWI
KPEQWYKDNKIDVMLDTNVTSVDSKAKKVKLCCGKEVAYDKLILCTGSKPFVPPLGQEGL
EGVLVIRTYLDVETLCKKCETAKSVVVIGGGVLGLENASNLEKKGLKVTVIECMPRLMSR
QLDPEGSHFLEDAVRKYGINLKLGHAVGIKSDGKNVTGVQVGDEFVPADFIVINAGVRPE
CDVAKTGGVEIGRGISVNEKMETNIPDIYAAGDCAYLKNFNQGLWAPALAMGKVAGANAA
GDDKTFSFAKEPVNMLAFNTDLFSIGCPPESEKGYNVIGQRDDKEGTLMRLYFQDNRLVY
ACCFKMQKISGALLKAAREGHSMQRVVAEVF
Download sequence
Identical sequences A2E972
84285.m00200 XP_001322980.1.43485 gi|121905836|gb|EAY10757.1| gi|123479646|ref|XP_001322980.1| 5722.A2E972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]