SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 84854.m00007 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  84854.m00007
Domain Number - Region: 96-125
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0361
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 84854.m00007
Sequence length 154
Sequence
KYIQKKRSQTQNIRNSTQFTLIPGTKVRVVLDDKLLTKKRLRLSRNYYIVDSTQGNGYLI
KAADDSIAFYPRHKLVESSNGKLAETIDEAKRGVVIEILGYNINDDTYKVRYEGGVEDVI
PSKNLRESKPTHLGPLEREYWKDKNMPERIRKFF
Download sequence
Identical sequences 84854.m00007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]