SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 85734.m00005 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  85734.m00005
Domain Number - Region: 125-154
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0602
Family Tudor domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 85734.m00005
Sequence length 183
Sequence
MKHFLEVYNSSTHSTTGHTPNSMTQQQEEKYIQKKRSQTQNIRNSTQFTLIPGTKVRVVL
DDKPLTKKRLRLSRNYYIVDSTQGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAK
RGVVIEILDYNTNDDTYKVRYEGGVEDVIPSKNLRESKPTHLGPLEREYWKDKNMPERIR
KFF
Download sequence
Identical sequences 100904.m00005 102394.m00005 138594.m00003 81781.m00005 82977.m00087 83814.m00005 84059.m00006 84610.m00014 85734.m00005 86259.m00006 88932.m00011 91956.m00006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]