SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 87150.m00173 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  87150.m00173
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000509
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Weak hits

Sequence:  87150.m00173
Domain Number - Region: 208-237
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0842
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 87150.m00173
Sequence length 266
Sequence
MKNKGTREVLRVLQKFVAEHSPSTLTSDQDSAYLSNEITEFLIKHNITHYTTEDHNHNIL
GIINRFIRTLRDLNQERDFTEETMKHFIEVYNSSTHSTTGHTPNSMTQQQEEKYIQKKRS
QTQNIRNSTQFTLIPGTKVRVVLDDKPLTKKRLRLSRNYYIVDSTQGNGYLIKAADDSIA
FYPRHKLVESSNGELAETIDEAKRGVVIEILDYNINDDTYKVRYEGGVEDVIPSKNLRES
KPTHLGPLEREYWKDKNMPERIRKFF
Download sequence
Identical sequences 87150.m00173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]