SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 87280.m00083 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  87280.m00083
Domain Number 1 Region: 61-200
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.56e-17
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Weak hits

Sequence:  87280.m00083
Domain Number - Region: 300-329
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0572
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 87280.m00083
Sequence length 358
Sequence
MSLKEVFESSPWRSFKKFYEAAKNAGFNDRTEIKRFYDENIVHQVKVNPYDYYLPIYSKT
HDAYQFDTLVQSKKGRKPPFLIFINVNTRKAFAYIMKNKGTKEVLRVLQTFVAEHHPTSL
TSDQDGAYLSNEITEFLIKHNVTHYTTEDHNHNILGIINRFIRTLRDLNKERDFTEESMN
KVINAYNKSTHNSTGFKPNEMTSKEEDEYIKQKRMLTEERRSSSLLPGTKVRIILEHKPH
EKVRNQLSDDYYIVDSSQGNGYLIKAADHSVAFYLRFRLVESENGRLAKTVDEAKRGIVN
KIVSYDEDKDEYTVIYEGGVDDKIPSRNLRESNPTHLSELEKDYWKDKNKPKLIKKFL
Download sequence
Identical sequences 87280.m00083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]