SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 87823.m00110 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  87823.m00110
Domain Number 1 Region: 75-305
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.7e-32
Family ROO N-terminal domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 87823.m00110
Sequence length 341
Sequence
MKSNQQVYGCIPENLPSYNDAHHANGYFVNNHGYPYAEYEDIGMGTARLFFKFFFGEKDV
TREMPHRNPKSDFNLGNGIRDWWIGHATNLIQIKDKFILTDPIFEKSCSPLKIGNSRKTP
AACKIEELPKISYVLISHSHYDHLNKGSVKKIKSLFPECHFLVPLGVGKILSSWGIKNYT
EFDWRTHLTIEDINFTCFPARHGSARSLSDSNVVLWCSWLIEYENVKIYFTGDTAIGPHF
AEIKETIGRGPDLMIAGIGPTAPSGMMRTVHMDGKDAWNMAKDIGAAKLTPMHYGTFPLG
MKPAKTDLDIFMENAEHGKELVINIGGRIDWNGTEFVKADL
Download sequence
Identical sequences A2EJ55
5722.A2EJ55 87823.m00110 XP_001319510.1.43485 gi|121902295|gb|EAY07287.1| gi|123472635|ref|XP_001319510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]