SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 88945.m00113 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  88945.m00113
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.93e-28
Family Ankyrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 88945.m00113
Sequence length 125
Sequence
MSECLKYHDPNQVCMEHAIISHNIDFVTFLMNEYKLDISLYHCTVFKNLESFYVYFDQTN
DINTCFAYSLKFNVTSLFEYFFSLGADIKAKNDCQQTALHCAADNNSKEMAEFLISHGAN
VNKKR
Download sequence
Identical sequences A2EXK3
XP_001314843.1.43485 88945.m00113 5722.A2EXK3 gi|121897501|gb|EAY02620.1| gi|123454036|ref|XP_001314843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]