SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 89034.m00138 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  89034.m00138
Domain Number 1 Region: 480-670
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.91e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0024
Further Details:      
 
Domain Number 2 Region: 11-281
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.18e-40
Family ROO N-terminal domain-like 0.0000476
Further Details:      
 
Domain Number 3 Region: 620-784
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.89e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0076
Further Details:      
 
Domain Number 4 Region: 260-406
Classification Level Classification E-value
Superfamily Flavoproteins 3.67e-27
Family Flavodoxin-related 0.0044
Further Details:      
 
Domain Number 5 Region: 434-470
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000269
Family Rubredoxin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 89034.m00138
Sequence length 871
Sequence
MLKIQQLTEDIYWLGALDPTLAVFDIIMETKYGTTYNAYMIKTPAGAVLVETVKECFFEE
YIEKVKSVIGDINNIKYLITNHTEPDHSGSIKKIIEIIPGLTVIGSKTALTYLEDIVNIP
FRGHSAEDLKALKFGGKTFEFISCPFLHWPDSMYTWLPEEQALFTCDSFGAHYSPKKSIL
MSELPPEEEDGYQEALLYYYTAIFGPFKDFVIKGTDKILDLDIKIICLGHGPVLDARVQE
TIDTYRKWSEPALPHPGIEVVMVYASAYGYTTEMAEEIKNGILDKIPDASVKMYNVNIQN
YGGMKADIMNSIATADGVLLGTNTINGDAVPPIWDVALSMNPIVHGGKIVTAFGSYGWSG
EGVDNIINRFDKIRCKVVEPIKIKFRMSKKEHKQVREFGRRFADCLESGEVPDRAVPGRV
VGAKDWSELNPTGAIVLWRCVICGEIYAGVTPPLVCPACGVGQDLFELYEAEEVTCSSFE
NLKFVVVGSGAAAVSAIDAIRARNTVASITMLTREKIMPYYRPIIVDALNSEISPENYYL
KNEDWYTENNITVKLGTTVKSIDTARKSLTLSDGSTMQYDRLILATGSRPFVPPIGHEGL
TGVYVIRTSNDVELLKETCKTAKKAVVIGGGVLGLENASAIKDRGLSVTVVECMPRLMAR
QLDPEASEILQGFVRDYGVDLRMGQCVVIKGDGKKVTGVQVGDEFISADFVVVNAGVRAE
SEVAAAAGIECSRGITVNNKMETSAQDVYAAGDCAYMENINQGLWAPALAMGKVAGANAA
GDSKTFHFSIEPVNMIAMGTDLFAVGIPPDSPKGYNVISQRDEKEGTAIKLYFKDNRLVY
AAGFKCQKQSGFLLKGVRNGHTLQHVLAELF
Download sequence
Identical sequences A2EP06
5722.A2EP06 89034.m00138 XP_001317833.1.43485 gi|121900577|gb|EAY05610.1| gi|123469240|ref|XP_001317833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]