SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 89678.m00200 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  89678.m00200
Domain Number 1 Region: 10-83
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-18
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 89678.m00200
Sequence length 89
Sequence
MSISCAVGLSEKRDEYEYTPLLQACNKGDLELTKSLIERGCARDAIDKNGNNCLFNAAFK
GHLVIVKYLVENGIDKNYRDNNDEFSAIL
Download sequence
Identical sequences A2E9Q1
XP_001322809.1.43485 gi|121905662|gb|EAY10586.1| gi|123479301|ref|XP_001322809.1| 89678.m00200 5722.A2E9Q1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]