SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 90013.m00073 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  90013.m00073
Domain Number 1 Region: 72-292
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.11e-31
Family ROO N-terminal domain-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 90013.m00073
Sequence length 363
Sequence
MSALNTIFITNLSTYTTRHHNGKRFINDPGEPMASKSNVNWFSIFKFAFQKDYVDPMPTR
NMTYDFNTKTNATRAWWINHATMLFQLDDKYIITDPIFDDHAAPFPWMIKRTSPTPITME
QLPKIDYILISHDHWDHLNYYSIKTLMGLNPNCTIIAPLGEGQLIRKWGYKVIIMDWRQQ
VKLGDIIITCFPARHMANRYGPLTMGRDLWASFLIEFKNATIYFTGDTAIGPHFKEVRDY
VGRPIDLCPMPIGPQEPNSLMRLVHLDPKQAADMSKILQTRVSFPIHWGTFPLGTKPEIP
DIIVLSQYWNEKQSGKLIVIKNGGYLEYVNGEFKLVDETSLIEQSYFEQQFVEYVQPKLP
EEL
Download sequence
Identical sequences A2F3W8
90013.m00073 gi|121895192|gb|EAY00384.1| gi|123449183|ref|XP_001313313.1| XP_001313313.1.43485 5722.A2F3W8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]