SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 90103.m00047 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  90103.m00047
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.82e-39
Family Ankyrin repeat 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 90103.m00047
Sequence length 174
Sequence
MSYAIASHNIDFVTFLMNEYNLKIDITDCIYYKNLQAFLVYLDKLNDVNKCVVESVHFNI
LSLCEFFITHGGDVNGKDAEGSIALHISAKDNKIDFVNMLLSHGANVNAKNNYGSSALHY
AVYSNSLEIIEALISHGAEVNIQNDYVQTPFVFATNEEIKNYLKSHGAKENKQN
Download sequence
Identical sequences A2FYI4
XP_001302973.1.43485 5722.A2FYI4 90103.m00047 gi|121884312|gb|EAX90043.1| gi|123407251|ref|XP_001302973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]