SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 90981.m00072 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  90981.m00072
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-26
Family Ankyrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 90981.m00072
Sequence length 115
Sequence
MSECLKYQKPNELCMEHAIISHNIDFVTFLMNEYKLEIDLLNCGIYKNLESFLVYFDQTN
DISKCFIYTVMFDTPSLCEYFITHGANIKEKDNDGHTALHIAAQYNHKEIAKLLI
Download sequence
Identical sequences A2FAW6
90981.m00072 gi|121892661|gb|EAX97943.1| gi|123440220|ref|XP_001310873.1| 5722.A2FAW6 XP_001310873.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]