SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 91175.m00007 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  91175.m00007
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-21
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 91175.m00007
Sequence length 89
Sequence
MNGSDINSKDNEGKTALHGAAINNNKVMVEYLISHGIKINAADNDGYTTLYYALAFVNKE
ISELLKSHGAIESAHDLSTERVNIEKEKM
Download sequence
Identical sequences A2H8Z7
5722.A2H8Z7 XP_001287050.1.43485 gi|121853768|gb|EAX74120.1| gi|123236949|ref|XP_001287050.1| 91175.m00007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]