SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 92043.m00143 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  92043.m00143
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.05e-27
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 92043.m00143
Sequence length 198
Sequence
MIGLILNHRDIIKLLISRGADINMQQSGGLSAIHLAILSNRRGNTNEGALSVEKLFGLHY
SKDFVNESEAKDLIELLPSNGANVNAKNDNGLTLLHMVSLKSTKEIAEILISHGAEINPL
TKNGLTPLDIAVGCEKIDYEIFLRLRKAKMDYQYYLDSFQEASKIVAFLKLNGGKANSGD
IRMTAFYNVSYYLNDYMM
Download sequence
Identical sequences A2F171
92043.m00143 XP_001330215.1.43485 5722.A2F171 gi|121896203|gb|EAY01362.1| gi|123975144|ref|XP_001330215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]