SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 92145.m00173 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  92145.m00173
Domain Number 1 Region: 13-151
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-38
Family Ankyrin repeat 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 92145.m00173
Sequence length 157
Sequence
MTKLLFYFLECHHFSNAASDEKITEFLIANGAYVKAHYSDGKTPLHLAANKSVIIAEVLI
SHGANINAKDIFGYTPLHIAVQSKYFSSMVKFLTEQGADVNAIDNDMKTPLHYVVEEYDP
SIDYVKILISSGANVNAMDINGNTPLQYAIKKIIKKL
Download sequence
Identical sequences A2EJS1
5722.A2EJS1 gi|121902149|gb|EAY07145.1| gi|123472347|ref|XP_001319368.1| XP_001319368.1.43485 92145.m00173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]