SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 92514.m00015 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  92514.m00015
Domain Number 1 Region: 59-132
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000626
Family Retroviral integrase, catalytic domain 0.019
Further Details:      
 
Weak hits

Sequence:  92514.m00015
Domain Number - Region: 235-264
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0963
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 92514.m00015
Sequence length 293
Sequence
MSLKEVFEQHPWRSFKKFNEAAKSWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY
LSNEITEFLIKHNITHYTTEDHNHNILGIINRFIRTLRDLNQERDFTEETMKHFLEVYNS
STHSTTGHTPNSMTQQQEEKYIQKKRSQTQNIRNSTQFTLIPGTKVRVVLDDKPLTKKRL
RLSRNYYIVDSTQGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAKRGVVIEILGY
NINDDTYKVRYEGGVEDVIPSKNLRESKPTHLGPLEREYWKDKNMPERIRKFF
Download sequence
Identical sequences 92514.m00015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]