SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 92921.m00314 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  92921.m00314
Domain Number 1 Region: 10-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-62
Family Ankyrin repeat 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 92921.m00314
Sequence length 223
Sequence
MSECLKYQKPDYKCMEYAIISHNIDFVTFLMNEYNIKIVLDYCAKYNNLEAFLVYFDQTN
DFNNCVFYSLIFNIPSLLEYFLSHGANINGKEYGKTALHIAARHNSKETVEFLISHDANI
NEKNKYGQTALHKAAENNSKETAEVLISHDANINEKDKYGKTTLHLAARNNSKEIAEHLI
SHGANINEKDKYGQTALHLATEYKSKETTEVLISHGANINEKR
Download sequence
Identical sequences A2DHL9
92921.m00314 gi|121915277|gb|EAY20067.1| gi|154416060|ref|XP_001581053.1| XP_001581053.1.43485 5722.A2DHL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]