SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 94431.m00003 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  94431.m00003
Domain Number - Region: 103-132
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0361
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 94431.m00003
Sequence length 161
Sequence
MTQQQEEKYIQKKRSQTQNIRNSTQFTLIPGTKVRVVLDDKPLTKKRLRLSRNYYIVDST
QGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAKRGVVIEILDYNINDDTYKVRYE
GGVEDVIPSKNLRESKPTHLGPLEREYWKDKNMPERIRKFF
Download sequence
Identical sequences 114298.m00003 129096.m00003 131461.m00003 134964.m00006 142679.m00005 82572.m00003 88331.m00027 90990.m00005 93576.m00090 94431.m00003 97393.m00011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]