SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 94522.m00006 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  94522.m00006
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000108
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Weak hits

Sequence:  94522.m00006
Domain Number - Region: 208-237
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0842
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 94522.m00006
Sequence length 266
Sequence
MKNKGTREVLRVLQKFVAEHSPSTLTSDQDGAYLSNEITDFLIKHNITHYTTEDHNHNIL
GIINRFIRTLRDLNQERDFTEETMKHFLEVYNSSTHSTTGHTPNSMTQQQEEKYIQKKRS
QTQNIRNSTQFTLIFGTKVRVVLDDKPLTKKRLRLSRNYYIVDSTQGNGYLIKAADDSIA
FYPRHKLVESSNGKLAETIDEAKRGVVIEILGYNINDDTYKVRYEGGVEDVIPSKNLRES
KPTHLGPLEREYWKDKNKPERIRKFF
Download sequence
Identical sequences 94522.m00006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]