SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 94652.m00101 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  94652.m00101
Domain Number 1 Region: 19-133
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000021
Family Ankyrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  94652.m00101
Domain Number - Region: 137-194
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0235
Family Mitotic arrest deficient-like 1, Mad1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 94652.m00101
Sequence length 312
Sequence
MTSSFPYASQVYFDLVKLGELDKIKEIKDMDFIVTAVLPKYKLNLYQYATLLGKLDIIKY
FDSINKDVFYSLDEQGNNPLHLSIISQSENSREVFDYFASRQDIIKSSNFANQTVLDLCI
QYNKIKMMFDIIQNYDDARELVSNLNNQKLKVSNLVEFTLDLLQSRTDDSEVKKLHEENQ
KLQAQIENLNNGNQIIEELRDLKEIIAEKDSEISLLKNLLYHSFNVEKPFEKVNVNVPED
KIKQIEQSAVKFSAPLWNMLSKFLRYFCDENTCNKILEKQNFAKYSVNLFELSLTLGYFS
ARLFFYVDKNLK
Download sequence
Identical sequences A2EQQ5
94652.m00101 gi|121899972|gb|EAY05020.1| gi|123467033|ref|XP_001317243.1| 5722.A2EQQ5 XP_001317243.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]