SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 95218.m00079 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  95218.m00079
Domain Number - Region: 100-129
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0572
Family Tudor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 95218.m00079
Sequence length 158
Sequence
MTSKEEDEYIKQKRMLTEERRSSSLLPGTKVRIILEYKPHEKVRNQLSDDYYIVDSSQGN
GYLIKAADHSVAFYPRFRLVESENGRLAKTVDEAKRGIVNKIVSSDEDKDEYTVIYEGGV
DDKIPSRNLRESNPTHLSELEKDYWKDKNKPKLIKNFL
Download sequence
Identical sequences A2F940
5722.A2F940 XP_001311498.1.43485 95218.m00079 gi|121893310|gb|EAX98568.1| gi|123445477|ref|XP_001311498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]