SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 95394.m00421 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  95394.m00421
Domain Number 1 Region: 7-180
Classification Level Classification E-value
Superfamily Flavoproteins 2.7e-31
Family Quinone reductase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 95394.m00421
Sequence length 181
Sequence
MSLKNAKVLIINAGFHCPPMANGRLNETLALEAEKYFQQKGHETKITHMEKGYKIDEEVV
KLDWADVIFFQTPTWWLGLPNPAKKYIDEVLNAYMGIQNKKAGKKFMISATFGALEETLY
DKNSCYEGKGPEAIWFPLYVGFKYIGIDKLPMVSFYNAFAQDFSIDNQVKRLHAHLDKVF
V
Download sequence
Identical sequences A2DFE3
XP_001581857.1.43485 gi|121916088|gb|EAY20871.1| gi|154417675|ref|XP_001581857.1| 95394.m00421 5722.A2DFE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]