SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 95978.m00068 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  95978.m00068
Domain Number - Region: 45-74
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0156
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 95978.m00068
Sequence length 103
Sequence
STQGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAKRGVVIEILDYNINDDTYKVR
YEGGVEDVIPSKNLRESKPTHLGPLEREYWKDKNMPERIRKFF
Download sequence
Identical sequences 143067.m00003 89636.m00005 94621.m00002 95978.m00068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]