SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 96531.m00009 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  96531.m00009
Domain Number - Region: 103-132
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0331
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 96531.m00009
Sequence length 150
Sequence
MTQQQEEKYIQKKRSQTQNIRNSTQFTLIPGTKVRVVLDDKPLTKKRLRLSRNYYIVDST
QGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAKRGVVIEILDYNINDDTYKVRYE
GGVEDVIPSKNLRESKPTHLGPLELEYWKE
Download sequence
Identical sequences 96531.m00009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]