SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 142640.m00003 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  142640.m00003
Domain Number - Region: 103-132
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0391
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 142640.m00003
Sequence length 161
Sequence
MTQQQEEKYIQKKRSQTQNIRNSTQFTLIPGTKVRVVLDDKPLTKKRLRLSRNYYIVDST
QGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAKRGVVIEILGYNINDDTYKVRYE
GGVEDVIPSKNLRESKPTHLGPLEREYWKDKNMPERIRKFF
Download sequence
Identical sequences 113052.m00003 127749.m00003 142640.m00003 92536.m00005 93418.m00056 97434.m00005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]