SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 80792.m00011 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  80792.m00011
Domain Number - Region: 88-195
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00314
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 80792.m00011
Sequence length 200
Sequence
MKLTTLTTNDFITVMDQSRSSIKAKELYMCTRNANISVQNFEDIVSILKSLQKYMKLRIL
DGVINFLIQTHKEISSSSEKIQNPQSEETFQNQPPKSDKKFELLNSQLNQINEKNSKERE
ILAEISELKKSNDFERVYNFLDQLSSQGNRKMISKSCDEGLLEKKYQKSPDDIEHVLHVA
SEKGNLSLVKSLMNMASTKI
Download sequence
Identical sequences A2GDU7
gi|121877825|gb|EAX84670.1| gi|123373290|ref|XP_001297600.1| XP_001297600.1.43485 5722.A2GDU7 80792.m00011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]