SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 82091.m00080 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  82091.m00080
Domain Number 1 Region: 284-567
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.67e-93
Family Ankyrin repeat 0.0000278
Further Details:      
 
Domain Number 2 Region: 47-52,135-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000085
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 82091.m00080
Sequence length 570
Sequence
MSDQDVHPNKYSELLSICKYDIDTYITLYQLKTENEEELNKIYKMIKKELIDSKKYRPQD
IIKDILDIIYYNNRYTKSYLYLAKLISDDYHVNEIEDFKSILNFLFYKEYGIKLDKFDDF
EKCKFENLDIHTDDTIYRAIMYNDLERFIYFIENEGFHQNQILICKLYPYTGKGYSLLEL
CCYHGAVDCFKLLRTKFKSEITQECLQFSFLGRNQEIMSECLKYQVPDNRCMKYAIISHN
IDFVTFLMNEYNMPIDLDYCEWHRNIESFLVYFDQTNDLNECFIYSVSFNITSLCEHFLS
LGANINEINKHGETALHYAAEKNNKEIAELLISCGANINEKNKYGETVLHYAAEKNNKEM
AELLISCGANINEKNKYGETVLHYAAEKNNKEMAELLISCGANINEKNKYGETVLHYAAE
KNNKEIAGLFISCGANINKKDNYTKTALHTAAEHNNKETAKLLISSGANINEKGNIGETA
LHYATRCNNKETVELLISCGANINEKNQYEETALHYATRYCNKEMAELLISLGANINEKN
KYEETALHYATMSNNISTVELLISHGATTY
Download sequence
Identical sequences A2FGV0
82091.m00080 5722.A2FGV0 gi|121890481|gb|EAX95854.1| gi|123434305|ref|XP_001308784.1| XP_001308784.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]