SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 86633.m00166 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  86633.m00166
Domain Number 1 Region: 287-481
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-55
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 47-52,140-257
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000144
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 86633.m00166
Sequence length 496
Sequence
MATIEGKKLSYNEAVSQYKGYIDTFNSIFKLKTTSKDEIKQIFEQIKTNLIEPKIFTSKL
LILSITNLVPYNNRYFKSYWELFKLIYEKYPVKKHYSEIPEFFDYFIYKQYGSVLDQNHE
GLFDKCEPNKYLFEIHEKNTIYRAIMDDDIELFITFIEREDFDKQKLLTSEFYPPSNKGY
SYLELCCYHGAVGCFKLLRTKFNSEITEDCLNLSFLGANQEIMNECLKFQKPTEESMGMA
IMSHNIDFVFYLLNEHGIKIDLSQCSRAYNVEVFLAHLDSTNDINGCFNASPIFNLLPLT
EYLFSLGADIDTKGEYDDTALHLSAQYNCAEIAEFLISQGADLNANNRFNQSPIFECCFL
DSAETAQVLISHGAKLNLTDNIYGETSLHKAAGSNCVKVAKILLENGENANAKEKHGKTP
LHVAAEHNYTEIAELLLSHGADINAKDNEGKTPLKYADENNNETFADFLISHGAELEEGD
VRKRRKRSSKSKKCII
Download sequence
Identical sequences A2EFG5
gi|121903595|gb|EAY08559.1| gi|123475207|ref|XP_001320782.1| 86633.m00166 XP_001320782.1.43485 5722.A2EFG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]