SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 86792.m00062 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  86792.m00062
Domain Number - Region: 125-154
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0451
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 86792.m00062
Sequence length 183
Sequence
MKHFLEVYNSSTHSTTGHTPNSMTQQQEEKYIQKKRSQTQNIRNSTQFTLIPGTKVRVVL
DDKPLTKKRLRLSRNYYIVDSTQGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAK
RGVVIEILDYNINDDTYKVRYEGGVEDVIPSKNLRESKPTHLGPLEREYWKDKNMPERIR
KFF
Download sequence
Identical sequences 109265.m00006 128587.m00003 135597.m00003 82119.m00080 85862.m00181 86792.m00062 88188.m00005 89105.m00066 92598.m00004 93904.m00245 97450.m00006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]