SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 89557.m00034 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  89557.m00034
Domain Number 1 Region: 288-572
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-108
Family Ankyrin repeat 0.0000164
Further Details:      
 
Domain Number 2 Region: 126-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000196
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 89557.m00034
Sequence length 573
Sequence
MSNQDIHPNKYSELRNTHKYYIDIYNSLYQLKSEKEEELKSIFKMIKTELIESNKHPPKD
IIKDILKIIPYNNRYTKSYLFLAKLFSDEYHVEEVKGISDISNILFYKEHGIKIDKSFDF
EKDDFENLDIHTENTIYRAIMNNDLEKFITFTGIDGFDKDQKLKSDLYPDSYEGYSLLEL
CCYHGAVDCFKFLRTKFNSEITQRCLELSFLGGNKEIMSECFKYQKPNEKCMEYAIISHN
IDFVTFLMNEYNIDIDLEICGFYNNLESFLVYFDQTNDINKCFVYSPIIGITSLTEYFIS
HGANINEKNNNGETALHIAALYNSKEIAEVLISHGANINEKDKNGDTALYYAAYNNSKET
AELLISHGANVNEKDQNGETALYYAAYNNSKETAELLISHGANINEKDQDGETALHKTAR
NNSKETAELLISHGANVNEKDQDGRTALHKAARNNNKEIAEILISHGANINEKDQDRETA
LHKTARNNSKETAELLISHGANINEKDQDGRTALHKAARNNNKEIAEILISHGANINEKD
QDRETALHKTARNNSKETAELLISHGVNINEKK
Download sequence
Identical sequences A2G5Q1
5722.A2G5Q1 89557.m00034 gi|121881495|gb|EAX87523.1| gi|123393764|ref|XP_001300453.1| XP_001300453.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]