SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 93469.m00003 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  93469.m00003
Domain Number 1 Region: 8-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.82e-37
Family Calponin-homology domain, CH-domain 0.00021
Further Details:      
 
Domain Number 2 Region: 189-244
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000157
Family EB1 dimerisation domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 93469.m00003
Sequence length 254
Sequence
MTNIEQLGKIPKNCAVGKNELLAWVNSICGVNYHKIEDCSNGAAFCQIMDAIYPDSIALG
KVNYDPVYESDIVNNFIILQESFNENKIQKNLNINELVRKKASATLEMMQWLYNYCSIYG
CVDNYDPYERRKNFNCKEPNVTRNSGVPVLSRRKSERTISSPTIHRRKTLDSNQSAQQSL
SESDSEKKVRKLEKSVTRLENELMATTKERQFYWEKLRDIEIYCNENQNESTKQILELLY
RLDADGEFIQPDEN
Download sequence
Identical sequences A2GKK4
XP_001295243.1.43485 gi|121873917|gb|EAX82313.1| gi|123350169|ref|XP_001295243.1| 5722.A2GKK4 93469.m00003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]