SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 93909.m00090 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  93909.m00090
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily MTH1598-like 1.7e-33
Family MTH1598-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 93909.m00090
Sequence length 145
Sequence
MYTEAKWEFIDHPADIQLHAWGPQPDVTLEQLGKAFFEVMFETDNFKEETTHSISVKGKD
AQNLLYNFLDEWLYVFDAEDFVATRIKVTKCDFVNLEIEATGYGELFDMKKHADFRRTEV
KAITYASMKVDTTPGASEFYVILDL
Download sequence
Identical sequences A2F1C4
gi|121896127|gb|EAY01288.1| gi|123974994|ref|XP_001314095.1| 5722.A2F1C4 93909.m00090 XP_001314095.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]