SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 94962.m00216 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  94962.m00216
Domain Number 1 Region: 283-610
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.25e-116
Family Ankyrin repeat 0.00000727
Further Details:      
 
Domain Number 2 Region: 120-249
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000128
Family Pseudo ankyrin repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 94962.m00216
Sequence length 612
Sequence
MSDQDTHSKKYSELRSMYQYSIDSYNALYQLKTENEEEIHKIFKMIKTELIDSKKLLPHT
IISDILCIIPYNYRYTKAYLSLAKLIYDNYQINKEIDAPLTVRYIFYKEYGIKLDKSDNF
ETINSKNLDIHTEDTIYRAIMYNDLERFITFTEIEGFDKDQKLKCDLYPYSYYGYSLLEL
CCYHGAVDCFKLLRTKFKSEITQTCLEFSFLGGNPEIMSECLKYQKPDKYCMFYAIISHN
IDFVTFLMNEYNLKVDLDVCVLYRNLESFLVYFDQTNDVNKCFLYSARFNIPSLCEYFLS
IGANVNGKDKYGQTALHYAAKYNRKEAAELLISHGANVNEKDKDGKTALHFTAVFNNSKE
IAELLISHGANVNEKDNNGRTALHYAAVFNNRKEIAELLISHGANINEKDKDEKTAFHIA
AEKNSKETAEFLISHGANINEKDKYGETALHFTAYNNSKEIAELLISHGANVNEKDKDGK
TALHSAAEKNSKETAELLISHGANVNEKNKHGKTALHYAAVFKNSKEIAELLISHGANVN
EKDNNGRTALHYAAVFNNRKEIAELLISHGANVNEKDKDEKTALHYATKFHRKEIAELLI
SHGANINEKNEE
Download sequence
Identical sequences A2DTI5
94962.m00216 gi|121911461|gb|EAY16294.1| gi|123503449|ref|XP_001328517.1| XP_001328517.1.43485 5722.A2DTI5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]