SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 95940.m00213 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  95940.m00213
Domain Number 1 Region: 226-578
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-90
Family Ankyrin repeat 0.00000913
Further Details:      
 
Domain Number 2 Region: 77-204
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000288
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 95940.m00213
Sequence length 588
Sequence
MIIEAVQMAAAFNNKYFRSYLKIFKKVYEEYHPAIYTPPSPAMLYFLYMDYGVLAFGITL
QTIQKLELKGFVLDVHPENTIYRAIMNDDIQSFIAFTERAGFDENQRFYNDFYEYSSRGY
TLLELCCYHGAVNCFKLLRTKFNSIISEKCLQMSFLGGNQEIMSECMKQVKPNKECMRYA
IMSHNNDFVSFLAEECNIEIVANECYLFYNLQALFILLDRTKDIGSCLVKSAYFNIPSLC
EYFLQHGANVNAMESDKFGMTAIHVATQFFNFETANFLLANGSDINIKSKIGLNPLHIAA
GKCGKEVLEFLISHGSDIKAKTREGNLAIHMAAISNQVKNTEYFLDHGFDINERNNEGVT
PLHIAVKYHSNDVADFLIQRGANINSKDLFDGTPLHFAARCKNREMVEVLVLLGADINAR
DNHQRTPLHCAGESTDTGAAEVLIAQGSDINAIDDVGFTVLHYAAEINCVKTAIFFISHG
ANVDAMAFANETPLIVAAAKNSTRVAEILILNGANINHKGIYGDNALHICAKYGSLNVAA
ILVKHGIDIKAKNFGGITPLEVAQRSRNFGMVIYLNMLYKAYGNLPNI
Download sequence
Identical sequences A2DPV3
gi|121912731|gb|EAY17549.1| gi|123508647|ref|XP_001329684.1| XP_001329684.1.43485 5722.A2DPV3 95940.m00213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]