SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 97241.m00134 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  97241.m00134
Domain Number 1 Region: 97-335
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.84e-31
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 20-117
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000144
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 97241.m00134
Sequence length 340
Sequence
MKSIIANDNDDALISLASNDIIIDSNGEKFDKQQIFILCCQYSACRCFNALYMQHSFQDV
DQDALVIAASTYGSVEILEMLHNLNVNLNSAFDASIISGKYDVLIYLYNSVYDDIASNLS
NKENLIHSVKGGNLDCVKFLIEMINDQEKLYDINYVNHDGDSALSVAIDKNRPDIVDYLI
RKGASLKTENNIIEKAIMTNNINVLGQFLKSPEFDPKSHVEFAITNKMEQSTALLLMYSK
RLSTPQLVHFLFIAVQNNLLNITKILLQNGIPGNATNDNKETILHIAASQGNSNMINLIL
NFGRNINVNALDIKRRTPIQRAISSGHPECVKLIIGKTDV
Download sequence
Identical sequences A2EAJ9
gi|121905381|gb|EAY10310.1| gi|123478744|ref|XP_001322533.1| XP_001322533.1.43485 5722.A2EAJ9 97241.m00134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]