SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 97908.m00003 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  97908.m00003
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000126
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Weak hits

Sequence:  97908.m00003
Domain Number - Region: 208-237
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0782
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 97908.m00003
Sequence length 250
Sequence
MRNKGTHEVLRVLQKFVAEHSPSILTSDQDGAYLSNEITEFLIKHNITHYTTEDHNHNIL
GIINRFIRTLRDLNQERDFTEETMKHFIEVYNSSTHSTTGHTPNSMTQQQEEKYIQKKRS
QTQNIRNSTQFTLIPGTKVRVVLDDKPLTKKRLRLSRNYYIVDSTQGNGYLIKAADNSIA
FYPRHKLVESSNGKLAETIDEAKRGVVIEILGYNINDDTYKVRYEGGVEDVIPSKNLRES
KPTHLGPLER
Download sequence
Identical sequences 97908.m00003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]