SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocmi1|107748|e_gw1.218.42.1 from Cochliobolus miyabeanus ATCC 44560 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocmi1|107748|e_gw1.218.42.1
Domain Number 1 Region: 28-284
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.19e-76
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.000000124
Further Details:      
 
Domain Number 2 Region: 376-544
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-47
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000015
Further Details:      
 
Domain Number 3 Region: 287-369
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000765
Family Rhamnogalacturonase B, RhgB, middle domain 0.0000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocmi1|107748|e_gw1.218.42.1
Sequence length 545
Sequence
MYLYTTTTTTTATLLLALTTLTTPTLAAFGVNKTKDSITIDSGSTAPFLFTVSTTSCDIT
SLNYAGEELQSPTKGSHIASGLGSATVSYDIIGTSYIKVTCTTPTLTQYIVAKAGEATIY
MATDITAEPEIGELRFIARLDSAKVGLSWPFGIVSTTANATGTVEGEDVFLVADGETRSK
FYSSERFIDDAVHCVYRDTNPIHVCLLMDSYSYETSAGGPFHRDINTNNAGPANSLTFYM
NSNHVQLEKYRMGMKGPYALSFSRSDIPKGGSSMDTTFFKDLSIPNYVPPSARGTVTGKA
TGVSSTAQAVVHWYNDAAQYWAYASSSSGTFTSPAMKPGTYTQVLYQGEFKVKAISVMVT
AGSTTTANIAADTEPKTSLWRIGEWDGQPKGFRNADKQLRMHPSDSRMAPWVPLTYTVGT
STLDSVPMALVKDLNPLTINFTSKQKNTAALSLRVGTTLAFAGCRPAVTLNTNFSPAVPA
APTKIASRGFTRGAYRGFGEVYDYAIPAGTLVEGANTIRISCLSGESGTGFLAPNVILDA
IELLE
Download sequence
Identical sequences W6ZAU3
jgi|Cocmi1|107748|e_gw1.218.42.1 XP_007692650.1.18027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]