SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocmi1|26890|fgenesh1_pg.78_#_9 from Cochliobolus miyabeanus ATCC 44560 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocmi1|26890|fgenesh1_pg.78_#_9
Domain Number 1 Region: 21-277
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-48
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000947
Further Details:      
 
Domain Number 2 Region: 369-545
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.79e-34
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000424
Further Details:      
 
Domain Number 3 Region: 283-361
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000235
Family Rhamnogalacturonase B, RhgB, middle domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocmi1|26890|fgenesh1_pg.78_#_9
Sequence length 547
Sequence
MRCLAALTALLLAPTAVFAAWGWTDDGKNYVIDTNANLVVKVSKSNADMTSIKYRGVEYN
GQNGKNSHVESGLAPGTVTIKQYTSPANIIKVTMKVGTLTHTLVFRYGNPNVYIFMNKRD
TSITVSRYIVRIPANIFTNNPNEDTDWVPNNAPAIESGDINGVNGQTWSKHYSGKKYGRT
IDYDYVGYTNANVGMYLIRSNHEKASGGPFFRSLIRRGGDGGPDLYDIYQYNMGHTDPMR
LGLQGPSVLHFTDNGAAPNHNLFARNANWDWFDSLEIEDWVPASRRGAVAGVGLANMKSG
FQYVVGLKNDQAQYWTIATGAWRIGNALPGTYTLTVYKGELEVHTSTVTISAGSTATRNT
ITLVDPNDTPAIWRIGDWDGTPRGLLNFQDTPMKPTYMHPSDSRLAKWDAGNFIIGTTPI
SSFPAYIWKDINNDHLVYFRLTDAQLARPAKIRLGVTQGQAGGRPTVSVNAWAAKLPTDK
GQGDTRSLTVGTYRGNNYVYEFEVPASAWVASAREYQILKITVISGKTAAGYLSPAVSFD
ALELVGL
Download sequence
Identical sequences W6ZML5
XP_007688624.1.18027 jgi|Cocmi1|26890|fgenesh1_pg.78_#_9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]