SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocmi1|40612|fgenesh1_pm.198_#_8 from Cochliobolus miyabeanus ATCC 44560 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocmi1|40612|fgenesh1_pm.198_#_8
Domain Number 1 Region: 134-320
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.47e-37
Family Hypothetical protein AT3g04780/F7O18 27 0.00051
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.74e-20
Family Thioltransferase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocmi1|40612|fgenesh1_pm.198_#_8
Sequence length 337
Sequence
MSGTVEIKSPAQLSSLLSSSRVVVVNFYNEQNLSSQTIAPVYDQLASQLSRPGKVTFTKV
STVQQAQIAQSYNVTNTPTFIIYKNNQQIRKYSGSNPQQLSEAIKTLAAEAENDGKGGSG
FASGSGGSGSGSGAWIGASLPRGYTDVTESVDVRGLDLLNADSDFGTVRTLFETSPPSSL
NKGKGAAASTEGNKDWIESDVDNQLMLYVPFTANVKLHTIHITSCTSGSDDDDDEAPVRP
KTIHVWINRQHNLGFEEAEDIPATQVIELKPSDWDEQTQTAKLELRFVKFQNVYSVVLFV
ADADGDSEKTRIDRVRFVGETGEKREMGKLEKIGHDD
Download sequence
Identical sequences W6YP93
XP_007692306.1.18027 jgi|Cocmi1|40612|fgenesh1_pm.198_#_8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]