SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocmi1|85944|e_gw1.18.149.1 from Cochliobolus miyabeanus ATCC 44560 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocmi1|85944|e_gw1.18.149.1
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-44
Family GABARAP-like 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocmi1|85944|e_gw1.18.149.1
Sequence length 119
Sequence
MRSKFKDEHPFEKRKAEAERIRQKYNDRIPVICEKVEKSDIATIDKKKYLVPADLTVGQF
VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEAL
Download sequence
Identical sequences E3RX05 M2S9R5 M2SQA5 N4X184 W6YSU5 W6ZZ07 W7EVT3
jgi|Cocvi1|85461|e_gw1.3.95.1 jgi|Cocmi1|85944|e_gw1.18.149.1 jgi|CocheC5_1|25792|estExt_fgenesh1_kg.C_120034 jgi|Cocca1|32428|fgenesh1_pm.5_#_61 EFQ89746 XP_003302160.1.2082 XP_007684559.1.18027 XP_007705035.1.66866 XP_007707196.1.9443 XP_014080593.1.79200 XP_014561898.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]