SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000118 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000118
Domain Number 1 Region: 51-130
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.87e-18
Family WD40-repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 295-341
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000811
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000118   Gene: ENSTBEG00000000143   Transcript: ENSTBET00000000142
Sequence length 342
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1349:509302:523809:-1 gene:ENSTBEG00000000143 transcript:ENSTBET00000000142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPKGFEAKSRSSKNDPKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSKKLWARHHPPVPDV
SCLILATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIW
DLNKHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGLRTPIAFAPESRGLCCTFPHSSIRAPGTRDGHVQFWTA
PRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF
Download sequence
Identical sequences ENSTBEP00000000118 ENSTBEP00000000118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]