SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000414 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000414
Domain Number 1 Region: 232-268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 190-221
Classification Level Classification E-value
Superfamily PKD domain 0.0000785
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000414   Gene: ENSTBEG00000000476   Transcript: ENSTBET00000000478
Sequence length 422
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1772:132897:215866:-1 gene:ENSTBEG00000000476 transcript:ENSTBET00000000478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGPRECPGPGGGGYSAMPDAIIRTKDSIAAGASFLRAPAEVLDWRQCVEACCAEPRCSV
AVVELPRRPASPAAALGCYLFNCTARGHSVCKFALHRGYSSYSLSRAQDRPEAAAAAPDT
ARASPRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
VPQSGTLKLSHLQEGTYTFQLTVTDTAGQRSSDNVSVTVLPTAYSTGGCSNVCSRYHFFC
DDGCCVDITLACDGVRQCPDGSDEAFCQNLGLDRKMTTHIATSPAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSSSGKNRKEKNYIFEPKS
DRGGEHPAPEAGAVLPLALGLAITAMLLLMVACRLRLVKQKLKKARPITSEESDYLINGM
YL
Download sequence
Identical sequences ENSTBEP00000000414 ENSTBEP00000000414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]